PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G346300.4.p
Common NameGLYMA_13G346300, LOC100812210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 982aa    MW: 107832 Da    PI: 6.0266
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G346300.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.41.7e-29597647252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Glyma.13G346300.4.p 597 EKNVSLSVLQQYFSGSLKDAAKNIGVCPTTLKRICRQHGIPRWPSRKINKV 647
                          89***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.166581667IPR003035RWP-RK domain
PfamPF020425.2E-26599647IPR003035RWP-RK domain
SuperFamilySSF542773.24E-21877966No hitNo description
PROSITE profilePS5174518.289881963IPR000270PB1 domain
SMARTSM006665.5E-19881963IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.0E-22882963No hitNo description
PfamPF005641.3E-14884962IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 982 aa     Download sequence    Send to blast
MEYPFSPKDR VIGDWQSSGA QLEGSASLDG RMINSISEDM PNSFSELMNF DTYAGLCYSP  60
SITDQILANE LPSFAPLSYP LPDGFNPVQL NSGQCCMSGV GRNNNDTENS SLYGEKVVCQ  120
QMDTLLGFLN DTNEANNLNS KLKINVSSQH LNNSDTGNYM MSRPPGLSLD ERMLRALSFF  180
KESAGGGILA QVWVPIKDGD QFILSTSEQP YLLDQMLAGY REVSRTFTFS AEGKSGCSLG  240
LPGRVFTSKV PEWTSNVGYY SMSEYLRFEH AINHKVCGSI AFPIFDLHSE LPCCAVLELV  300
TTNEKPDFDR ELEIVCRALQ LVNLRTAKPL RCLPQCLSNN KKATLTEIVD VLRSVCHAHR  360
LPLGLTWIPC CFTECSRGEA SSIRIEGGHS TSRGKNILCL EESACYITDR AMGGFVRACM  420
EHRLEEGKGI AGKALQSNHP FFYPDVKTYD ISEYPLVHHA RKYNLNAAVA IRLRSTYTND  480
DDYILEFFLP VNMKGSSEQQ LLLDNLSGTM QRICSSLRTV SETELSGMES LAVGLGKKNA  540
PSFFPLSSRN SEIPLINGDC DSVQKATNLR DNEIESSPNQ ERNGSKRQVQ KNRSTSEKNV  600
SLSVLQQYFS GSLKDAAKNI GVCPTTLKRI CRQHGIPRWP SRKINKVNRS LKKIQTVLDS  660
VQGVEGGLKV LDSVQGVEGV LKFDPSMGAF VAGGSIIQEI DAHKSTIKDP VPVAQDAFSV  720
RPAPCSEGEN FSIKLEGKLK KTNVSSVNYS EDSKSMAIND GSCQTASLCT KVQDCPEQAC  780
LGSVLAKEHD KRILNKGGLS VEKFKRNIVG QSSKTLIGDE MDIGVDGDDG VVERNHPTSS  840
SLIDSSNGSG SMMHSSSSGS QSFKNQDQSK VKSTIVDSRS KLIVKATYRE DTIRFKFDPC  900
AGCFSLYEEV AARFKLQNGL FQLKYLDDEE EWVMLVNNAD LQECIEILDD IGTRSVRFLV  960
RDMPSVLGSS GSSNSYLGGS S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0283180.0EU028318.1 Glycine max clone BAC gmw1-45b2 genomic sequence.
GenBankEU0283190.0EU028319.1 Glycine max clone BAC gmw1-91g6 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595078.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_006595077.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_006595076.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_006595079.10.0PREDICTED: protein NLP8 isoform X1
RefseqXP_014621587.10.0PREDICTED: protein NLP8 isoform X1
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLK7M3K80.0K7M3K8_SOYBN; Uncharacterized protein
STRINGGLYMA13G42160.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein